PDB entry 3cg0

View 3cg0 on RCSB PDB site
Description: Crystal structure of signal receiver domain of modulated diguanylate cyclase from Desulfovibrio desulfuricans G20, an example of alternate folding
Class: lyase
Keywords: SIGNAL RECEIVER DOMAIN, DIGUANYLATE CYCLASE, PROTEIN STRUCTURE INITIATIVE, PSI-2, New York SGX Research Center for Structural Genomics, NYSGXRC, STRUCTURAL GENOMICS, LYASE
Deposited on 2008-03-04, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor
    Species: Desulfovibrio desulfuricans [TaxId:207559]
    Gene: Dde_1631
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q311G8 (Start-131)
      • expression tag (132)
    Domains in SCOPe 2.07: d3cg0a1, d3cg0a2
  • Chain 'B':
    Compound: Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor
    Species: Desulfovibrio desulfuricans [TaxId:207559]
    Gene: Dde_1631
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q311G8 (Start-131)
      • expression tag (132)
    Domains in SCOPe 2.07: d3cg0b1, d3cg0b2
  • Chain 'C':
    Compound: Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor
    Species: Desulfovibrio desulfuricans [TaxId:207559]
    Gene: Dde_1631
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q311G8 (Start-131)
      • expression tag (132)
    Domains in SCOPe 2.07: d3cg0c1, d3cg0c2
  • Chain 'D':
    Compound: Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor
    Species: Desulfovibrio desulfuricans [TaxId:207559]
    Gene: Dde_1631
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q311G8 (Start-131)
      • expression tag (132)
    Domains in SCOPe 2.07: d3cg0d1, d3cg0d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cg0A (A:)
    msltasddlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialv
    dimlcgaldgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhr
    siemaihkkkleeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cg0A (A:)
    dlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialvdimlcga
    ldgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhrsiemaih
    kkklee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cg0B (B:)
    msltasddlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialv
    dimlcgaldgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhr
    siemaihkkkleeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cg0B (B:)
    lpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialvdimlcgal
    dgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhrsiemaihk
    kklee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cg0C (C:)
    msltasddlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialv
    dimlcgaldgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhr
    siemaihkkkleeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cg0C (C:)
    dlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialvdimlcga
    ldgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhrsiemaih
    kkklee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cg0D (D:)
    msltasddlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialv
    dimlcgaldgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhr
    siemaihkkkleeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cg0D (D:)
    dlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialvdimlcga
    ldgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhrsiemaih
    kkklee