PDB entry 3cfy

View 3cfy on RCSB PDB site
Description: Crystal structure of signal receiver domain of putative Luxo repressor protein from Vibrio parahaemolyticus
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, UNCHARACTERIZED PROTEIN, SIGNAL RECEIVER DOMAIN, AAA-ATPASE, PROTEIN STRUCTURE INITIATIVE, PSI-2, New York SGX Research Center for Structural Genomics, NYSGXRC, ATP-binding, DNA-binding, Nucleotide-binding, Transcription, Transcription regulation
Deposited on 2008-03-04, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative LuxO repressor protein
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VP1469
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87PN2 (3-129)
      • expression tag (2)
      • expression tag (130-131)
    Domains in SCOPe 2.07: d3cfya1, d3cfya2, d3cfya3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cfyA (A:)
    mslrprvllvedstslailykqyvkdepydifhvetgrdaiqfierskpqliildlklpd
    msgedvldwinqndiptsviiatahgsvdlavnliqkgaedflekpinadrlktsvalhl
    krakledlveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfyA (A:)
    lrprvllvedstslailykqyvkdepydifhvetgrdaiqfierskpqliildlklpdms
    gedvldwinqndiptsviiatahgsvdlavnliqkgaedflekpinadrlktsvalhlkr
    akledlvegh