PDB entry 3cfw

View 3cfw on RCSB PDB site
Description: L-selectin lectin and EGF domains
Class: cell adhesion
Keywords: L-selectin, lectin, EGF, Cell adhesion, EGF-like domain, Glycoprotein, Membrane, Sushi, Transmembrane
Deposited on 2008-03-04, released 2008-03-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-selectin
    Species: Homo sapiens [TaxId:9606]
    Gene: L-selectin, SELL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cfwa1, d3cfwa2
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cfwA (A:)
    wtyhysekpmnwqrarrfcrdnytdlvaiqnkaeieylektlpfsrsyywigirkiggiw
    twvgtnkslteeaenwgdgepnnkknkedcveiyikrnkdagkwnddachklkaalcyta
    scqpwscsghgecveiinnytcncdvgyygpqcqfvqvdprlid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfwA (A:)
    wtyhysekpmnwqrarrfcrdnytdlvaiqnkaeieylektlpfsrsyywigirkiggiw
    twvgtnkslteeaenwgdgepnnkknkedcveiyikrnkdagkwnddachklkaalcyta
    scqpwscsghgecveiinnytcncdvgyygpqcqfv