PDB entry 3cfc

View 3cfc on RCSB PDB site
Description: High-resolution structure of blue fluorescent antibody EP2-19G2
Class: immune system
Keywords: immunoglobulin, blue-fluorescent antibody, hapten complex, immune system, electron transfer
Deposited on 2008-03-03, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: blue fluorescent antibody ep2-19g2-igg2b heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFC (0-212)
  • Chain 'L':
    Compound: blue fluorescent antibody ep2-19g2-kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFC (0-218)
    Domains in SCOPe 2.06: d3cfcl1, d3cfcl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cfcL (L:)
    divmtqaafsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlelpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec