PDB entry 3cel

View 3cel on RCSB PDB site
Description: active-site mutant e212q determined at ph 6.0 with cellobiose bound in the active site
Deposited on 1996-08-24, released 1997-03-12
The last revision prior to the SCOP 1.59 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d3cel__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cel_ (-)
    esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
    cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepssnnantgigghgsccsqmdiweansisealtphpcttvgqeiceg
    dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
    nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
    ikfgpigstgnpsg