PDB entry 3cei

View 3cei on RCSB PDB site
Description: Crystal Structure of Superoxide Dismutase from Helicobacter pylori
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2008-02-29, released 2008-06-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Helicobacter pylori [TaxId:210]
    Gene: SOD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ceia1, d3ceia2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Helicobacter pylori [TaxId:210]
    Gene: SOD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ceib1, d3ceib2
  • Heterogens: FE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ceiA (A:)
    mftlrelpfakdsmgdflspvafdfhhgkhhqtyvnnlnnlikgtdfeksslfailtkss
    ggvfnnaaqiynhdfywdclspkatalsdelkgalekdfgslekfkedfiksattlfgsg
    wnwaaynldtqkieiiqtsnaqtpvtdkkvpllvvdvwehayyidhknarpvylekfygh
    inwhfvsqcyewakkeglgsvdyyinelvhkkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ceiB (B:)
    mftlrelpfakdsmgdflspvafdfhhgkhhqtyvnnlnnlikgtdfeksslfailtkss
    ggvfnnaaqiynhdfywdclspkatalsdelkgalekdfgslekfkedfiksattlfgsg
    wnwaaynldtqkieiiqtsnaqtpvtdkkvpllvvdvwehayyidhknarpvylekfygh
    inwhfvsqcyewakkeglgsvdyyinelvhkkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ceiB (B:)
    mftlrelpfakdsmgdflspvafdfhhgkhhqtyvnnlnnlikgtdfeksslfailtkss
    ggvfnnaaqiynhdfywdclspkatalsdelkgalekdfgslekfkedfiksattlfgsg
    wnwaaynldtqkieiiqtsnaqtpvtdkkvpllvvdvwehayyidhknarpvylekfygh
    inwhfvsqcyewakkeglgsvdyyinelvh