PDB entry 3cdp

View 3cdp on RCSB PDB site
Description: Crystal structure of PPAR-gamma LBD complexed with a partial agonist, analogue of clofibric acid
Class: transcription
Keywords: bundle of alpha-helices and a small four-stranded beta-sheet, Activator, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Receptor, Transcription, Transcription regulation, Zinc-finger
Deposited on 2008-02-27, released 2009-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cdpa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cdpb_
  • Heterogens: YRG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cdpA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdpA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cdpB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdpB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl