PDB entry 3cdk

View 3cdk on RCSB PDB site
Description: Crystal structure of the co-expressed succinyl-CoA transferase A and B complex from Bacillus subtilis
Class: transferase
Keywords: CO-EXPRESSED COMPLEX, HETERO-TETRAMER, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Transferase
Deposited on 2008-02-27, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.196
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: scoA, yxjD, BSU38990, N15K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cdka_
  • Chain 'B':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B
    Species: Bacillus subtilis [TaxId:1423]
    Gene: scoB, yxjE, BSU38980, N15L
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: scoA, yxjD, BSU38990, N15K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cdkc_
  • Chain 'D':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B
    Species: Bacillus subtilis [TaxId:1423]
    Gene: scoB, yxjE, BSU38980, N15L
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cdkA (A:)
    snamgkvlssskeaaklihdgdtliaggfglcgipeqlilsirdqgvkdltvvsnncgvd
    dwglglllankqikkmiasyvgenkiferqflsgelevelvpqgtlaeriraggagipgf
    ytatgvgtsiaegkehktfggrtyvlergitgdvaivkawkadtmgnlifrktarnfnpi
    aamagkitiaeaeeiveageldpdhihtpgiyvqhvvlgasqekriekrtvqqasgkgea
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdkA (A:)
    gkvlssskeaaklihdgdtliaggfglcgipeqlilsirdqgvkdltvvsnncgvddwgl
    glllankqikkmiasyvgenkiferqflsgelevelvpqgtlaeriraggagipgfytat
    gvgtsiaegkehktfggrtyvlergitgdvaivkawkadtmgnlifrktarnfnpiaama
    gkitiaeaeeiveageldpdhihtpgiyvqhvvlgasqekriekrtvqq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cdkC (C:)
    snamgkvlssskeaaklihdgdtliaggfglcgipeqlilsirdqgvkdltvvsnncgvd
    dwglglllankqikkmiasyvgenkiferqflsgelevelvpqgtlaeriraggagipgf
    ytatgvgtsiaegkehktfggrtyvlergitgdvaivkawkadtmgnlifrktarnfnpi
    aamagkitiaeaeeiveageldpdhihtpgiyvqhvvlgasqekriekrtvqqasgkgea
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdkC (C:)
    mgkvlssskeaaklihdgdtliaggfglcgipeqlilsirdqgvkdltvvsnncgvddwg
    lglllankqikkmiasyvgenkiferqflsgelevelvpqgtlaeriraggagipgfyta
    tgvgtsiaegkehktfggrtyvlergitgdvaivkawkadtmgnlifrktarnfnpiaam
    agkitiaeaeeiveageldpdhihtpgiyvqhvvlgasqekriekrtvq
    

  • Chain 'D':
    No sequence available.