PDB entry 3cdf

View 3cdf on RCSB PDB site
Description: kI O18/O8 Y87H immunoglobulin light chain variable domain
Class: immune system
Keywords: Greek key beta barrel, amyloid, immunoglobulin, light chain, variable domain, IMMUNE SYSTEM
Deposited on 2008-02-26, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.191
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immuglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDF (Start-108)
    Domains in SCOPe 2.07: d3cdfa_
  • Chain 'B':
    Compound: immuglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDF (0-108)
    Domains in SCOPe 2.07: d3cdfb_
  • Chain 'C':
    Compound: immuglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDF (Start-108)
    Domains in SCOPe 2.07: d3cdfc_
  • Chain 'D':
    Compound: immuglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDF (0-108)
    Domains in SCOPe 2.07: d3cdfd_
  • Chain 'E':
    Compound: immuglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDF (Start-108)
    Domains in SCOPe 2.07: d3cdfe_
  • Chain 'F':
    Compound: immuglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDF (0-108)
    Domains in SCOPe 2.07: d3cdff_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cdfA (A:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdfA (A:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cdfB (B:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cdfC (C:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdfC (C:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cdfD (D:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cdfE (E:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdfE (E:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cdfF (F:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik