PDB entry 3cdc

View 3cdc on RCSB PDB site
Description: kI O18/O8 N34I/Y87H immunoglobulin light chain variable domain
Class: immune system
Keywords: Greek key beta barrel, amyloid, immunoglobulin, light chain, variable domain, IMMUNE SYSTEM
Deposited on 2008-02-26, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.191
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light Chain Amyloidogenic
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDC (0-108)
    Domains in SCOPe 2.08: d3cdca_
  • Chain 'B':
    Compound: Light Chain Amyloidogenic
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDC (0-108)
    Domains in SCOPe 2.08: d3cdcb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cdcA (A:)
stdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cdcB (B:)
stdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik