PDB entry 3cdc
View 3cdc on RCSB PDB site
Description: kI O18/O8 N34I/Y87H immunoglobulin light chain variable domain
Class: immune system
Keywords: Greek key beta barrel, amyloid, immunoglobulin, light chain, variable domain, IMMUNE SYSTEM
Deposited on
2008-02-26, released
2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-06-09, with a file datestamp of
2009-06-05.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.191
AEROSPACI score: 0.61
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Light Chain Amyloidogenic
Species: Homo sapiens [TaxId:9606]
Gene: kI O18/O8 germline
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3cdca_ - Chain 'B':
Compound: Light Chain Amyloidogenic
Species: Homo sapiens [TaxId:9606]
Gene: kI O18/O8 germline
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3cdcb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3cdcA (A:)
stdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3cdcB (B:)
stdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik