PDB entry 3cch
View 3cch on RCSB PDB site
Description: H-2Db complex with murine gp100
Class: immune system
Keywords: murine MHC, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Disease mutation, Melanin biosynthesis, IMMUNE SYSTEM
Deposited on
2008-02-25, released
2009-03-10
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.243
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: H-2 class I histocompatibility antigen, D-B alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-D1
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3cchb_ - Chain 'C':
Compound: nonameric peptide murine gp100
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: H-2 class I histocompatibility antigen, D-B alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-D1
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3cche_ - Chain 'F':
Compound: nonameric peptide murine gp100
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: H-2 class I histocompatibility antigen, D-B alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-D1
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3cchh_ - Chain 'I':
Compound: nonameric peptide murine gp100
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: H-2 class I histocompatibility antigen, D-B alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-D1
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3cchk_ - Chain 'L':
Compound: nonameric peptide murine gp100
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3cchB (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>3cchE (E:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>3cchH (H:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
Sequence; same for both SEQRES and ATOM records: (download)
>3cchK (K:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'L':
No sequence available.