PDB entry 3cc5
View 3cc5 on RCSB PDB site
Description: H-2Db complex with human gp100
Class: Immune System
Keywords: murine MHC, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Secreted, Melanin biosynthesis, Immune System
Deposited on
2008-02-24, released
2009-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.23
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: H-2 class I histocompatibility antigen, D-B alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-D1
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3cc5b_ - Chain 'C':
Compound: nonameric peptide from Melanocyte protein Pmel 17
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: H-2 class I histocompatibility antigen, D-B alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-D1
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3cc5e_ - Chain 'F':
Compound: nonameric peptide from Melanocyte protein Pmel 17
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3cc5B (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>3cc5E (E:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'F':
No sequence available.