PDB entry 3cc5

View 3cc5 on RCSB PDB site
Description: H-2Db complex with human gp100
Class: Immune System
Keywords: murine MHC, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Secreted, Melanin biosynthesis, Immune System
Deposited on 2008-02-24, released 2009-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.23
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: H-2 class I histocompatibility antigen, D-B alpha chain
  Species: Mus musculus [TaxId:10090]
  Gene: H2-D1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01899 (0-275)
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.06: d3cc5b_
• Chain 'C':
  Compound: nonameric peptide from Melanocyte protein Pmel 17
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40967 (0-8)
• Chain 'D':
  Compound: H-2 class I histocompatibility antigen, D-B alpha chain
  Species: Mus musculus [TaxId:10090]
  Gene: H2-D1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01899 (0-275)
• Chain 'E':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.06: d3cc5e_
• Chain 'F':
  Compound: nonameric peptide from Melanocyte protein Pmel 17
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40967 (0-8)
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cc5B (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cc5E (E:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'F':
  No sequence available.