PDB entry 3cbd

View 3cbd on RCSB PDB site
Description: Directed Evolution of cytochrome P450 BM3, to octane monoxygenase 139-3
Class: oxidoreductase
Keywords: Cytochrome P450, Hemeprotein 139-3, Electron transport, FAD, Flavoprotein, FMN, Iron, Membrane, Metal-binding, Monooxygenase, Multifunctional enzyme, NADP, Oxidoreductase, Transport
Deposited on 2008-02-21, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.211
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional P-450/NADPH-P450 reductase
    Species: Bacillus megaterium
    Gene: CYP102
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779 (0-454)
      • engineered (77)
      • engineered (137)
      • engineered (174)
      • engineered (177)
      • engineered (183)
      • engineered (235)
      • engineered (251)
      • engineered (254)
      • engineered (289)
      • engineered (294)
      • engineered (352)
    Domains in SCOPe 2.07: d3cbda_
  • Chain 'B':
    Compound: Bifunctional P-450/NADPH-P450 reductase
    Species: Bacillus megaterium
    Gene: CYP102
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779 (0-454)
      • engineered (77)
      • engineered (137)
      • engineered (174)
      • engineered (177)
      • engineered (183)
      • engineered (235)
      • engineered (251)
      • engineered (254)
      • engineered (289)
      • engineered (294)
      • engineered (352)
    Domains in SCOPe 2.07: d3cbdb_
  • Heterogens: HEM, 140, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cbdA (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfardfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadeyievpedmtrltldtiglcgfnyrfnsfyrdqphpfiismira
    ldevmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddlltqmlng
    kdpetgeplddgnisyqiitfliaghettsgllsfalyflvknphvlqkvaeeatrvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdevmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cbdB (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfardfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadeyievpedmtrltldtiglcgfnyrfnsfyrdqphpfiismira
    ldevmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddlltqmlng
    kdpetgeplddgnisyqiitfliaghettsgllsfalyflvknphvlqkvaeeatrvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdevmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl