PDB entry 3cab

View 3cab on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from Apis mellifera soaked at pH 7.0
Class: pheromone-binding protein
Keywords: honeybee, Apis mellifera, pheromone binding protein, signal transduction, queen mandibular pheromone, PHEROMONE-BINDING PROTEIN
Deposited on 2008-02-19, released 2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.178
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pheromone-binding protein ASP1
    Species: Apis mellifera
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3caba_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3cabA (A:)
apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

    Sequence, based on observed residues (ATOM records): (download) 
    >3cabA (A:)
dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi