PDB entry 3c92

View 3c92 on RCSB PDB site
Description: Thermoplasma acidophilum 20S proteasome with a closed gate
Class: hydrolase
Keywords: protein complex, Hydrolase, Protease, Proteasome, Threonine protease
Deposited on 2008-02-14, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: EM
Resolution: 6.8 Å
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c9211
  • Chain '2':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c9221
  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92a1
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92b1
  • Chain 'C':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92c1
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92d1
  • Chain 'E':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92e1
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92f1
  • Chain 'G':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92g1
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92h1
  • Chain 'I':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92i1
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92j1
  • Chain 'K':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92k1
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92l1
  • Chain 'M':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92m1
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92n1
  • Chain 'O':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92o1
  • Chain 'P':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92p1
  • Chain 'Q':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92q1
  • Chain 'R':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92r1
  • Chain 'S':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92s1
  • Chain 'T':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92t1
  • Chain 'U':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92u1
  • Chain 'V':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92v1
  • Chain 'W':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92w1
  • Chain 'X':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92x1
  • Chain 'Y':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92y1
  • Chain 'Z':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c92z1

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c921 (1:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c922 (2:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c92A (A:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92A (A:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c92B (B:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92B (B:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c92C (C:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92C (C:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c92D (D:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92D (D:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3c92E (E:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92E (E:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3c92F (F:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92F (F:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3c92G (G:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92G (G:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92H (H:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92I (I:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92J (J:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92K (K:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92L (L:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92M (M:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92N (N:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3c92O (O:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92O (O:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3c92P (P:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92P (P:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3c92Q (Q:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92Q (Q:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3c92R (R:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92R (R:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3c92S (S:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92S (S:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3c92T (T:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92T (T:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3c92U (U:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c92U (U:)
    raitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiql
    iddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggv
    rpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekea
    vtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92V (V:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92W (W:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92X (X:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92Y (Y:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c92Z (Z:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil