PDB entry 3c91

View 3c91 on RCSB PDB site
Description: Thermoplasma acidophilum 20S proteasome with an open gate
Class: hydrolase
Keywords: protein peptide complex, peptide not modeled., Cytoplasm, Hydrolase, Protease, Proteasome, Threonine protease
Deposited on 2008-02-14, released 2008-08-05
The last revision prior to the SCOP 1.75 freeze date was dated 2008-08-26, with a file datestamp of 2008-08-22.
Experiment type: EM
Resolution: 6.8 Å
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c9111
  • Chain '2':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c9121
  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91a1
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91b1
  • Chain 'C':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91c1
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91d1
  • Chain 'E':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91e1
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91f1
  • Chain 'G':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91g1
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91h1
  • Chain 'I':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91i1
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91j1
  • Chain 'K':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91k1
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91l1
  • Chain 'M':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91m1
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91n1
  • Chain 'O':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91o1
  • Chain 'P':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91p1
  • Chain 'Q':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91q1
  • Chain 'R':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91r1
  • Chain 'S':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91s1
  • Chain 'T':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91t1
  • Chain 'U':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91u1
  • Chain 'V':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91v1
  • Chain 'W':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91w1
  • Chain 'X':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91x1
  • Chain 'Y':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91y1
  • Chain 'Z':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c91z1

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c911 (1:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c912 (2:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c91A (A:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91A (A:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c91B (B:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91B (B:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c91C (C:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91C (C:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c91D (D:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91D (D:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3c91E (E:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91E (E:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3c91F (F:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91F (F:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3c91G (G:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91G (G:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91H (H:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91I (I:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91J (J:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91K (K:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91L (L:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91M (M:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91N (N:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3c91O (O:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91O (O:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3c91P (P:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91P (P:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3c91Q (Q:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91Q (Q:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3c91R (R:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91R (R:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3c91S (S:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91S (S:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3c91T (T:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91T (T:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3c91U (U:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c91U (U:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91V (V:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91W (W:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91X (X:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91Y (Y:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c91Z (Z:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil