PDB entry 3c6n

View 3c6n on RCSB PDB site
Description: Small molecule agonists and antagonists of F-box protein-substrate interactions in auxin perception and signaling
Class: signaling protein
Keywords: Auxin, ubiquitin ligase, small molecules, plant physiology, chemical biology, Auxin signaling pathway, Chromosome partition, Cytoplasm, Cytoskeleton, Developmental protein, Ethylene signaling pathway, Nucleus, Ubl conjugation pathway, Cell cycle, Leucine-rich repeat, Plant defense, SIGNALING PROTEIN
Deposited on 2008-02-04, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SKP1-like protein 1A
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: SKP1A, ASK1, SKP1, UIP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q39255 (Start-159)
  Domains in SCOPe 2.08: d3c6na_
• Chain 'B':
  Compound: transport inhibitor response 1
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: TIR1, FBL1, WEI1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q570C0
• Heterogens: IHP, 2S8, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3c6nA (A:)
  msakkivlkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakvieyck
  rhveaaaskaeavegaatsdddlkawdadfmkidqatlfelilaanylniknlldltcqt
  vadmikgktpeeirttfnikndftpeeeeevrrenqwafe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3c6nA (A:)
  aanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeeevrrenqwafe
  

  
  
• Chain 'B':
  No sequence available.