PDB entry 3c6e

View 3c6e on RCSB PDB site
Description: Crystal structure of the precursor membrane protein- envelope protein heterodimer from the dengue 2 virus at neutral pH
Class: viral protein
Keywords: beta barrel, prM-E protein complex structure, Helicase, Hydrolase, Nucleotide-binding, RNA replication, Transmembrane, VIRAL PROTEIN
Deposited on 2008-02-04, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.25
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Dengue virus 2 Thailand/16681/84 [TaxId:31634]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O09234 (8-401)
      • expression tag (4-7)
    Domains in SCOPe 2.06: d3c6ea1, d3c6ea2, d3c6ea3
  • Chain 'C':
    Compound: prM
    Species: Dengue virus [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, NDG, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c6eA (A:)
    genlyfqgmrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakq
    patlrkycieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkgg
    ivtcamfrckknmegkvvqpenleytivitphsgeehavgndtgkhgkeikitpqssite
    aeltgygtvtmecsprtgldfnemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwi
    qketlvtfknphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdkl
    qlkgmsysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrli
    tvnpivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c6eA (A:)
    yfqgmrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatl
    rkycieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkggivtc
    amfrckknmegkvvqpenleytivitphsgeehagkhgkeikitpqssiteaeltgygtv
    tmecsprtldfemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknp
    hakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmct
    gkfkvvkeiaetqhgtivirvqygdgspckipfeimdlekrhvlgrlitvnpivtekdsp
    vnieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'C':
    No sequence available.