PDB entry 3c66

View 3c66 on RCSB PDB site
Description: Yeast poly(A) polymerase in complex with Fip1 residues 80-105
Class: transferase
Keywords: Peptide-protein complex, mRNA processing, Nucleus, RNA-binding, Transferase, Phosphoprotein
Deposited on 2008-02-02, released 2008-05-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: poly(a) polymerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PAP1, YKR002W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29468 (Start-525)
      • expression tag (526-531)
    Domains in SCOPe 2.04: d3c66a1, d3c66a2, d3c66a3
  • Chain 'B':
    Compound: poly(a) polymerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PAP1, YKR002W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29468 (Start-525)
      • expression tag (526-530)
    Domains in SCOPe 2.04: d3c66b1, d3c66b2, d3c66b3
  • Chain 'C':
    Compound: Pre-mRNA polyadenylation factor FIP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Pre-mRNA polyadenylation factor FIP1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c66A (A:)
    mssqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaq
    rfvyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvf
    dsllrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnl
    dekdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlv
    aricqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrm
    pvitpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykf
    yleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccptedd
    yemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfnienkkekvd
    ihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrpskkskrkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c66A (A:)
    sqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrf
    vyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfds
    llrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnlde
    kdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlvar
    icqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpv
    itpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykfyl
    eitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccpteddye
    miqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfninkkekvdihi
    pctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrpskk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c66B (B:)
    mssqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaq
    rfvyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvf
    dsllrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnl
    dekdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlv
    aricqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrm
    pvitpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykf
    yleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccptedd
    yemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfnienkkekvd
    ihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrpskkskrkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c66B (B:)
    sqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrf
    vyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfds
    llrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnlde
    kdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlvar
    icqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpv
    itpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykfyl
    eitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccpteddye
    miqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfnienkkekvdih
    ipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrpsk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.