PDB entry 3c5x

View 3c5x on RCSB PDB site
Description: Crystal structure of the precursor membrane protein- envelope protein heterodimer from the dengue 2 virus at low pH
Class: viral protein
Keywords: BETA BARREL, prM-E protein complex, Helicase, Hydrolase, Nucleotide-binding, RNA replication, Transmembrane, VIRAL PROTEIN
Deposited on 2008-02-01, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.253
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Dengue virus 2 Thailand/16681/84 [TaxId:31634]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O09234 (8-401)
      • expression tag (4-7)
    Domains in SCOPe 2.06: d3c5xa1, d3c5xa2, d3c5xa3
  • Chain 'C':
    Compound: prM
    Species: Dengue virus 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SHD, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c5xA (A:)
    genlyfqgmrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakq
    patlrkycieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkgg
    ivtcamfrckknmegkvvqpenleytivitphsgeehavgndtgkhgkeikitpqssite
    aeltgygtvtmecsprtgldfnemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwi
    qketlvtfknphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdkl
    qlkgmsysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrli
    tvnpivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5xA (A:)
    yfqgmrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatl
    rkycieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkggivtc
    amfrckknmegkvvqpenleytivitphsgeehgkhgkeikitpqssiteaeltgygtvt
    mecsprglfnemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknph
    akkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctg
    kfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdsp
    vnieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'C':
    No sequence available.