PDB entry 3c5s

View 3c5s on RCSB PDB site
Description: Crystal Structure of monoclonal Fab F22-4 specific for Shigella flexneri 2a O-Ag
Class: immune system
Keywords: Antibody, O-Antigen, LPS, Shigella flexneri, IMMUNE SYSTEM
Deposited on 2008-02-01, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab F22-4 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C5S (0-End)
    Domains in SCOPe 2.07: d3c5sa1, d3c5sa2
  • Chain 'B':
    Compound: Fab F22-4 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C5S (0-End)
  • Chain 'C':
    Compound: Fab F22-4 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C5S (0-End)
    Domains in SCOPe 2.07: d3c5sc1, d3c5sc2
  • Chain 'D':
    Compound: Fab F22-4 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C5S (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c5sA (A:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5sA (A:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c5sC (C:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5sC (C:)
    divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
    sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'D':
    No sequence available.