PDB entry 3c5f

View 3c5f on RCSB PDB site
Description: Structure of a binary complex of the R517A Pol lambda mutant
Class: Transferase, Lyase/DNA
Keywords: helix hairpin helix, DNA damage, DNA repair, DNA replication, DNA synthesis, DNA-binding, DNA-directed DNA polymerase, Lyase, Manganese, Metal-binding, Nucleotidyltransferase, Nucleus, Phosphoprotein, Polymorphism, Transferase, Lyase-DNA COMPLEX
Deposited on 2008-01-31, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: HOMO SAPIENS
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-334)
      • engineered (276)
    Domains in SCOPe 2.07: d3c5fa1, d3c5fa2, d3c5fa3
  • Chain 'B':
    Compound: DNA polymerase lambda
    Species: HOMO SAPIENS
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-334)
      • engineered (276)
    Domains in SCOPe 2.07: d3c5fb1, d3c5fb2, d3c5fb3
  • Chain 'D':
    Compound: DNA (5'-d(p*dgp*dcp*dcp*dg)-3')
  • Chain 'E':
    Compound: DNA (5'-d(p*dgp*dcp*dcp*dg)-3')
  • Chain 'P':
    Compound: DNA (5'-d(*dcp*dap*dgp*dtp*dap*dc)-3')
  • Chain 'Q':
    Compound: DNA (5'-d(*dcp*dap*dgp*dtp*dap*dc)-3')
  • Chain 'T':
    Compound: DNA (5'-d(*dcp*dgp*dgp*dcp*dcp*dgp*dtp*dap*dcp*dtp*dg)-3')
  • Chain 'U':
    Compound: DNA (5'-d(*dcp*dgp*dgp*dcp*dcp*dgp*dtp*dap*dcp*dtp*dg)-3')
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c5fA (A:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmaalaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5fA (A:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmaalaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c5fB (B:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmaalaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5fB (B:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmaalaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.