PDB entry 3c5c

View 3c5c on RCSB PDB site
Description: Crystal structure of human Ras-like, family 12 protein in complex with GDP
Class: signaling protein
Keywords: ras, rasl12, gdp, gtpase, Structural Genomics Consortium, SGC, limited proteolysis, GTP-binding, Nucleotide-binding, SIGNALING PROTEIN
Deposited on 2008-01-31, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAS-like protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RASL12, RIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c5ca_
  • Chain 'B':
    Compound: RAS-like protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RASL12, RIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c5cb_
  • Chain 'C':
    Compound: RAS-like protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RASL12, RIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NYN1 (18-End)
      • expression tag (17)
    Domains in SCOPe 2.07: d3c5cc1, d3c5cc2
  • Chain 'D':
    Compound: RAS-like protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RASL12, RIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c5cd_
  • Heterogens: MG, GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c5cA (A:)
    mhhhhhhssgrenlyfqgplevnlailgrrgagksaltvkfltkrfiseydpnledtyss
    eetvdhqpvhlrvmdtadldtprncerylnwahaflvvysvdsrqsfdssssylellalh
    aketqrsipalllgnkldmaqyrqvtkaegvalagrfgclffevsacldfehvqhvfhea
    vrearre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5cA (A:)
    levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadp
    rncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldmaqy
    rqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c5cB (B:)
    mhhhhhhssgrenlyfqgplevnlailgrrgagksaltvkfltkrfiseydpnledtyss
    eetvdhqpvhlrvmdtadldtprncerylnwahaflvvysvdsrqsfdssssylellalh
    aketqrsipalllgnkldmaqyrqvtkaegvalagrfgclffevsacldfehvqhvfhea
    vrearre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5cB (B:)
    levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadl
    dtprncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldm
    aqyrqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c5cC (C:)
    mhhhhhhssgrenlyfqgplevnlailgrrgagksaltvkfltkrfiseydpnledtyss
    eetvdhqpvhlrvmdtadldtprncerylnwahaflvvysvdsrqsfdssssylellalh
    aketqrsipalllgnkldmaqyrqvtkaegvalagrfgclffevsacldfehvqhvfhea
    vrearre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5cC (C:)
    gplevnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdta
    dlprncerylnwahaflvvysvdsrqsfdssssylellalhaketqpalllgnkldmaqy
    rqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c5cD (D:)
    mhhhhhhssgrenlyfqgplevnlailgrrgagksaltvkfltkrfiseydpnledtyss
    eetvdhqpvhlrvmdtadldtprncerylnwahaflvvysvdsrqsfdssssylellalh
    aketqrsipalllgnkldmaqyrqvtkaegvalagrfgclffevsacldfehvqhvfhea
    vrearre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5cD (D:)
    levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadl
    rncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldmaqy
    rqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr