PDB entry 3c4f

View 3c4f on RCSB PDB site
Description: FGFR TYROSINE KINASE DOMAIN IN COMPLEX WITH 3-(3-methoxybenzyl)-7-azaindole
Class: transferase
Keywords: FIBROBLAST GROWTH FACTOR RECEPTOR, TYROSINE KINASE DOMAIN, RECEPTOR TYROSINE KINASE, FGFR1, FGFR, Alternative splicing, ATP-binding, Chromosomal rearrangement, Disease mutation, Dwarfism, Glycoprotein, Heparin-binding, Immunoglobulin domain, Kallmann syndrome, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-01-29, released 2008-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, FGFBR, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (0-301)
      • engineered (24)
    Domains in SCOPe 2.07: d3c4fa_
  • Chain 'B':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, FGFBR, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (0-301)
      • engineered (24)
    Domains in SCOPe 2.07: d3c4fb_
  • Heterogens: C4F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c4fA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
    cynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
    lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
    vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
    qe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c4fA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeql
    sskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyyk
    kttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllke
    ghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c4fB (B:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
    cynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
    lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
    vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
    qe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c4fB (B:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeql
    sskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyyk
    kttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllke
    ghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe