PDB entry 3c3m

View 3c3m on RCSB PDB site
Description: Crystal structure of the N-terminal domain of response regulator receiver protein from Methanoculleus marisnigri JR1
Class: signaling protein
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, SIGNALING PROTEIN
Deposited on 2008-01-28, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver protein
    Species: Methanoculleus marisnigri [TaxId:368407]
    Gene: Memar_0295, Memar_0309
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3CS79 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3c3ma1, d3c3ma2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c3mA (A:)
    mslytilvvddspmivdvfvtmlerggyrpitafsgeeclealnatppdlvlldimmepm
    dgwetleriktdpatrdipvlmltakpltpeeaneygsyiedyilkptthhqlyeaiehv
    larrhsiaadeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3mA (A:)
    slytilvvddspmivdvfvtmlerggyrpitafsgeeclealnatppdlvlldimmepmd
    gwetleriktdpatrdipvlmltakpltpeeaneygsyiedyilkptthhqlyeaiehvl
    arr