PDB entry 3c2s

View 3c2s on RCSB PDB site
Description: Structural Characterization of a Human Fc Fragment Engineered for Lack of Effector Functions
Class: immune system
Keywords: Fc fragment, mutant, effector function, Receptor, PROTEIN BINDING, IMMUNE SYSTEM
Deposited on 2008-01-25, released 2008-08-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IGHM protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PYX1
      • engineered (108)
    Domains in SCOPe 2.04: d3c2sa1, d3c2sa2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c2sA (A:)
    thtcppcpapefeggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgv
    evhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpasiektiskakgq
    prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c2sA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpasiektiskakgqprepqvytlppsr
    eemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslsp