PDB entry 3c22

View 3c22 on RCSB PDB site
Description: Crystal structure of the carbohydrate recognition domain of human Langerin
Class: immune system, sugar binding protein
Keywords: C-type lectin domain, Coiled coil, Glycoprotein, Membrane, Signal-anchor, Transmembrane, IMMUNE SYSTEM, SUGAR BINDING PROTEIN
Deposited on 2008-01-24, released 2009-01-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3c22a_
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3c22b_
  • Chain 'C':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3c22c_
  • Chain 'D':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3c22d_
  • Heterogens: CA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c22A (A:)
    aswshpqfekiegrmqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshlts
    vtseseqeflyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgepnnagnn
    ehcgnikapslqawndapcdktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c22A (A:)
    sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl
    tkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktf
    lfickrpyvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c22B (B:)
    aswshpqfekiegrmqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshlts
    vtseseqeflyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgepnnagnn
    ehcgnikapslqawndapcdktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c22B (B:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
    ickrpyvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c22C (C:)
    aswshpqfekiegrmqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshlts
    vtseseqeflyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgepnnagnn
    ehcgnikapslqawndapcdktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c22C (C:)
    vsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywig
    ltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdkt
    flfickrpyvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c22D (D:)
    aswshpqfekiegrmqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshlts
    vtseseqeflyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgepnnagnn
    ehcgnikapslqawndapcdktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c22D (D:)
    vsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywig
    ltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdkt
    flfickrpyvpsep