PDB entry 3c0v

View 3c0v on RCSB PDB site
Description: Crystal structure of cytokinin-specific binding protein in complex with cytokinin and Ta6Br12
Class: plant protein
Keywords: MAD, Ta6Br12 complex, CYTOKININS, ZEATIN, PATHOGENESIS-RELATED PROTEINS, Plant defense, PLANT PROTEIN
Deposited on 2008-01-21, released 2008-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytokinin-specific binding protein
    Species: Vigna radiata
    Gene: vrcsbp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZWP8 (0-End)
      • see remark 999 (91)
    Domains in SCOPe 2.06: d3c0va_
  • Chain 'B':
    Compound: cytokinin-specific binding protein
    Species: Vigna radiata
    Gene: vrcsbp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZWP8 (0-End)
      • see remark 999 (91)
    Domains in SCOPe 2.06: d3c0vb_
  • Chain 'C':
    Compound: cytokinin-specific binding protein
    Species: Vigna radiata
    Gene: vrcsbp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZWP8 (0-End)
      • see remark 999 (91)
    Domains in SCOPe 2.06: d3c0vc_
  • Chain 'D':
    Compound: cytokinin-specific binding protein
    Species: Vigna radiata
    Gene: vrcsbp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZWP8 (0-End)
      • see remark 999 (91)
    Domains in SCOPe 2.06: d3c0vd_
  • Heterogens: NA, ZEA, TBR, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c0vA (A:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsngsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c0vA (A:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrleryls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c0vB (B:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsngsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c0vB (B:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrleryls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c0vC (C:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsngsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c0vC (C:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrleryls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c0vD (D:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsngsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c0vD (D:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsn