PDB entry 3c09

View 3c09 on RCSB PDB site
Description: Crystal structure the Fab fragment of matuzumab (Fab72000) in complex with domain III of the extracellular region of EGFR
Class: immune system/transferase
Keywords: CELL SURFACE RECEPTOR, GLYCOPROTEIN, ANTIGEN, ANTIBODY COMPLEX, FAB FRAGMENT, ANTITUMOR, DRUG IMMUNE SYSTEM-TRANSFERASE COMPLEX, IMMUNE SYSTEM-TRANSFERASE complex
Deposited on 2008-01-18, released 2008-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.245
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.06: d3c09a1, d3c09a2, d3c09a3
  • Chain 'B':
    Compound: Matuzumab Fab Light chain
    Species: , [TaxId:9606,10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C09 (0-End)
  • Chain 'C':
    Compound: Matuzumab Fab Heavy chain
    Species: , [TaxId:9606,10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C09 (0-End)
    Domains in SCOPe 2.06: d3c09c1, d3c09c2
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.06: d3c09d1, d3c09d2, d3c09d3
  • Chain 'H':
    Compound: Matuzumab Fab Heavy chain
    Species: , [TaxId:9606,10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C09 (0-End)
    Domains in SCOPe 2.06: d3c09h1, d3c09h2
  • Chain 'L':
    Compound: Matuzumab Fab Light chain
    Species: , [TaxId:9606,10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3C09 (0-End)
  • Heterogens: NAG, BMA, MAN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c09A (A:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c09A (A:)
    kkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld
    ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl
    keisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspe
    gcwgpeprdcv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c09C (C:)
    qvqlvqsgaevkkpgasvkvsckasgytftshwmhwvrqapgqglewigefnpsngrtny
    nekfkskatmtvdtstntaymelsslrsedtavyycasrdydyagryfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c09C (C:)
    qvqlvqsgaevkkpgasvkvsckasgytftshwmhwvrqapgqglewigefnpsngrtny
    nekfkskatmtvdtstntaymelsslrsedtavyycasrdydyagryfdywgqgtlvtvs
    sastkgpsgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvyicnvn
    hkpsntkvdkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c09D (D:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c09D (D:)
    kkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld
    ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl
    keisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspe
    gcwgpeprdcv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3c09H (H:)
    qvqlvqsgaevkkpgasvkvsckasgytftshwmhwvrqapgqglewigefnpsngrtny
    nekfkskatmtvdtstntaymelsslrsedtavyycasrdydyagryfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c09H (H:)
    qvqlvqsgaevkkpgasvkvsckasgytftshwmhwvrqapgqglewigefnpsngrtny
    nekfkskatmtvdtstntaymelsslrsedtavyycasrdydyagryfdywgqgtlvtvs
    sastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    No sequence available.