PDB entry 3byt

View 3byt on RCSB PDB site
Description: A complex between a variant of staphylococcal enterotoxin C3 and the variable domain of the murine T cell receptor beta chain 8.2
Class: toxin
Keywords: Secreted, Superantigen, TOXIN
Deposited on 2008-01-16, released 2009-05-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell receptor beta chain 8.2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BYT (0-End)
    Domains in SCOPe 2.04: d3byta_
  • Chain 'B':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (Start-238)
      • see remark 999 (104-105)
    Domains in SCOPe 2.04: d3bytb1, d3bytb2
  • Chain 'C':
    Compound: T cell receptor beta chain 8.2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BYT (0-108)
    Domains in SCOPe 2.04: d3bytc_
  • Chain 'D':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (Start-238)
      • see remark 999 (102)
      • see remark 999 (104-105)
    Domains in SCOPe 2.04: d3bytd1, d3bytd2
  • Chain 'E':
    Compound: T cell receptor beta chain 8.2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BYT (0-108)
    Domains in SCOPe 2.04: d3byte_
  • Chain 'F':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (Start-238)
      • see remark 999 (104-105)
    Domains in SCOPe 2.04: d3bytf1, d3bytf2
  • Chain 'G':
    Compound: T cell receptor beta chain 8.2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BYT (0-108)
    Domains in SCOPe 2.04: d3bytg_
  • Chain 'H':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (Start-238)
      • see remark 999 (105)
    Domains in SCOPe 2.04: d3byth1, d3byth2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bytA (A:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bytB (B:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnkastwhgktcmyggitkheg
    nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bytB (B:)
    sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
    dkvktellnedlakkykdevvdvygsnyyvncyfsstwhgktcmyggitkhegnhfdngn
    lqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgyik
    fienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bytC (C:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bytD (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnkastwhgktcmyggitkheg
    nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bytD (D:)
    sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
    dkvktellnedlakkykdevvdvygsnyyvncyfssstwhgktcmyggitkhegnhfdng
    nlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgyi
    kfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bytE (E:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bytF (F:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnkastwhgktcmyggitkheg
    nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bytF (F:)
    sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
    dkvktellnedlakkykdevvdvygsnyyvncyfsskdtwhgktcmyggitkhegnhfdn
    gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
    ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bytG (G:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3bytH (H:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnkastwhgktcmyggitkheg
    nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bytH (H:)
    sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
    dkvktellnedlakkykdevvdvygsnyyvncyfsshgktcmyggitkhegnhfdngnlq
    nvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgyikfi
    enngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng