PDB entry 3bym

View 3bym on RCSB PDB site
Description: X-ray co-crystal structure aminobenzimidazole triazine 1 bound to Lck
Class: transferase
Keywords: Lck, kinase domain, Alternative splicing, ATP-binding, Chromosomal rearrangement, Cytoplasm, Disease mutation, Host-virus interaction, Lipoprotein, Membrane, Myristate, Nucleotide-binding, Palmitate, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-01-16, released 2008-09-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3byma_
  • Heterogens: SO4, AM0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bymA (A:)
qkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaea
nlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqia
egmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtap
eainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeel
yqlmrlcwkerpedrptfdylrsvledfftat