PDB entry 3byd

View 3byd on RCSB PDB site
Description: Crystal structure of beta-lactamase OXY-1-1 from Klebsiella oxytoca
Class: hydrolase
Keywords: Multi-domain proteins (alpha and beta), Antibiotic resistance, Hydrolase
Deposited on 2008-01-15, released 2009-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.184
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase OXY-1
    Species: Klebsiella oxytoca [TaxId:571]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3byda_
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bydA (A:)
    slwasadaiqqkladlekrsggrlgvalintaddsqtlyrgderfamcstgkvmaaaavl
    kqsesnpevvnkrleikksdlvvwspitekhlqsgmtlaelsaaalqysdntamnkmisy
    lggpekvtafaqsigdvtfrldrtepalnsaipgdkrdtttplamaeslrkltlgnalge
    qqraqlvtwlkgnttggqsiraglpaswavgdktgagdygttndiaviwpenhaplvlvt
    yftqpqqdaksrkevlaaaakivtegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bydA (A:)
    daiqqkladlekrsggrlgvalintaddsqtlyrgderfamcstgkvmaaaavlkqsesn
    pevvnkrleikksdlvvwspitekhlqsgmtlaelsaaalqysdntamnkmisylggpek
    vtafaqsigdvtfrldrtepalnsaipgdkrdtttplamaeslrkltlgnalgeqqraql
    vtwlkgnttggqsiraglpaswavgdktgagdygttndiaviwpenhaplvlvtyftqpq
    qdaksrkevlaaaakivtegl