PDB entry 3bx3

View 3bx3 on RCSB PDB site
Description: Puf4 T650C/C724R Mutant bound to Cox17 RNA 3' UTR recognition sequence
Class: transcription, RNA binding protein/RNA
Keywords: Puf4, Pumilio, RNA Binding, HO endonuclease, Puf4 T650C C724R mutant, TRANSCRIPTION, RNA BINDING PROTEIN/RNA COMPLEX
Deposited on 2008-01-11, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.29
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein PUF4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PUF4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25339
      • engineered (96)
      • engineered (170)
    Domains in SCOPe 2.07: d3bx3a_
  • Chain 'B':
    Compound: Protein PUF4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PUF4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25339
      • engineered (96)
      • engineered (170)
    Domains in SCOPe 2.07: d3bx3b_
  • Chain 'C':
    Compound: COX17 RNA target sequence
  • Chain 'D':
    Compound: COX17 RNA target sequence
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bx3A (A:)
    srfadavldqyigsihslckdqhgcrflqkqldilgskaadaifeetkdytvelmtdsfg
    nyliqklleevtteqrivltkissphfveislnphgcralqklieciktdeeaqivvdsl
    rpytvqlskdlngnhviqkclqrlkpenfqfifdaisdscidiathrhgcrvlqrcldhg
    tteqcdnlcdkllalvdkltldpfgnyvvqyiitkeaeknkydythkivhllkpraiels
    ihkfgsnviekilktaivsepmileilnnggetgiqsllndsygnyvlqtaldishkqnd
    ylykrlseivapllvgpirntphgkriigmlhlds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bx3A (A:)
    dqyigsihslckdqhgcrflqkqldilgskaadaifeetkdytvelmtdsfgnyliqkll
    eevtteqrivltkissphfveislnphgcralqklieciktdeeaqivvdslrpytvqls
    kdlngnhviqkclqrlkpenfqfifdaisdscidiathrhgcrvlqrcldhgtteqcdnl
    cdkllalvdkltldpfgnyvvqyiitkeaeknkydythkivhllkpraielsihkfgsnv
    iekilktaivsepmileilnnggetgiqsllndsygnyvlqtaldishkqndylykrlse
    ivapllvgpirntphgkriigmlhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bx3B (B:)
    srfadavldqyigsihslckdqhgcrflqkqldilgskaadaifeetkdytvelmtdsfg
    nyliqklleevtteqrivltkissphfveislnphgcralqklieciktdeeaqivvdsl
    rpytvqlskdlngnhviqkclqrlkpenfqfifdaisdscidiathrhgcrvlqrcldhg
    tteqcdnlcdkllalvdkltldpfgnyvvqyiitkeaeknkydythkivhllkpraiels
    ihkfgsnviekilktaivsepmileilnnggetgiqsllndsygnyvlqtaldishkqnd
    ylykrlseivapllvgpirntphgkriigmlhlds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bx3B (B:)
    dilgskaadaifeetkdytvelmtdsfgnyliqklleevtteqrivltkissphfveisl
    nphgcralqklieciktdeeaqivvdslrpytvqlskdlngnhviqkclqrlkpenfqfi
    fdaisdscidiathrhgcrvlqrcldhgtteqcdnlcdkllalvdkltldpfgnyvvqyi
    itkeaeknkydythkivhllkpraielsihkfgsnviekilktaivsepmileilnngge
    tgiqsllndsygnyvlqtaldishkqndylykrlseivapllvgpirntphgkriigmlh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.