PDB entry 3bwy

View 3bwy on RCSB PDB site
Description: Crystal Structure of Human 108M Catechol O-methyltransferase bound with S-adenosylmethionine and inhibitor dinitrocatechol
Class: transferase
Keywords: COMT, methyltransferase, polymorphism, Rossmann fold, SAM, DNC
Deposited on 2008-01-10, released 2008-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.126
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COMT protein
    Species: HOMO SAPIENS
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bwya_
  • Heterogens: MG, SAM, DNC, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bwyA (A:)
    gdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsv
    llelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagmkdkvtlvvgasqd
    iipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdfla
    hvrgsscfecthyqsfleyrevvdglekaiykgp