PDB entry 3bwt

View 3bwt on RCSB PDB site
Description: Crystal structure of the RNA binding domain of Puf4 from Saccharomyces cerevisiae
Class: transcription, RNA binding protein
Keywords: Puf4, Pumilio, RNA Binding, HO endonuclease, TRANSCRIPTION, RNA BINDING PROTEIN
Deposited on 2008-01-10, released 2008-03-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein PUF4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PUF4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3bwta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bwtA (A:)
srfadavldqyigsihslckdqhgcrflqkqldilgskaadaifeetkdytvelmtdsfg
nyliqklleevtteqrivltkissphfveislnphgtralqklieciktdeeaqivvdsl
rpytvqlskdlngnhviqkclqrlkpenfqfifdaisdscidiathrhgccvlqrcldhg
tteqcdnlcdkllalvdkltldpfgnyvvqyiitkeaeknkydythkivhllkpraiels
ihkfgsnviekilktaivsepmileilnnggetgiqsllndsygnyvlqtaldishkqnd
ylykrlseivapllvgpirntphgkriigmlhl