PDB entry 3bwd

View 3bwd on RCSB PDB site
Description: Crystal structure of the plant Rho protein ROP5
Class: plant protein
Keywords: G domain, Cytoplasm, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Prenylation, ----, PLANT PROTEIN
Deposited on 2008-01-09, released 2008-03-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.248
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Rac-like GTP-binding protein ARAC6
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ARAC6, RAC2, ROP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3bwdd_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bwdD (D:)
    gsmsasrfikcvtvgdgavgktcllisytsntfptdyvptvfdnfsanvvvngatvnlgl
    wdtagqedynrlrplsyrgadvfilafsliskasyenvskkwipelkhyapgvpivlvgt
    kldlrddkqffidhpgavpittvqgeelkkligapayiecssksqenvkgvfdaairvvl
    qp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwdD (D:)
    rfikcvtvgdgavgktcllisytsntfpfsanvvlglwdtagedynrlrplsyrgadvfi
    lafsliskasyenvskkwipelkhyapgvpivlvgtkldlrddkqffidhavpittvqge
    elkkligapayiecssksqenvkgvfdaairvvlqp