PDB entry 3bw5

View 3bw5 on RCSB PDB site
Description: Crystal structure of a mutant of human protein kinase CK2alpha with altered cosubstrate specificity
Class: transferase
Keywords: protein kinase ck2, casein kinase 2, casein kinase II, ATP-binding, Nucleotide-binding, Serine/threonine-protein kinase, Transferase, Wnt signaling pathway
Deposited on 2008-01-08, released 2008-01-22
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-04, with a file datestamp of 2008-02-29.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.147
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: HOMO SAPIENS
    Gene: csnk2a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68400 (Start-334)
      • engineered (65)
      • engineered (162)
    Domains in SCOP 1.75: d3bw5a1
  • Heterogens: CL, ANP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bw5A (A:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvavkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvlidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bw5A (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvavkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvlidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqarmg