PDB entry 3bvm

View 3bvm on RCSB PDB site
Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Class: toxin
Keywords: N-terminal Oligosaccharide/oligonucleotide fold, Enterotoxin, Secreted, Superantigen, Toxin
Deposited on 2008-01-07, released 2009-05-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enterotoxin type C-3
    Species: STAPHYLOCOCCUS AUREUS
    Gene: entC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3bvma1, d3bvma2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bvmA (A:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnkwwpgktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bvmA (A:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfgktcmyggitkhegnhfdngnlqnv
    lvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgyikfien
    ngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk