PDB entry 3bvg

View 3bvg on RCSB PDB site
Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Class: toxin
Keywords: Enterotoxin, Secreted, Superantigen, Toxin
Deposited on 2008-01-07, released 2009-01-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enterotoxin type C-3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3bvga1, d3bvga2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bvgA (A:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdastwhgktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bvgA (A:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfgktcmyggitkhegnhfdngnlqnv
    lvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgyikfien
    ngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng