PDB entry 3bve

View 3bve on RCSB PDB site
Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
Class: Oxidoreductase
Keywords: iron storage, Metal-binding, Oxidoreductase
Deposited on 2008-01-07, released 2009-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (7-13)
    Domains in SCOPe 2.05: d3bvea_
  • Chain 'B':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (7-13)
    Domains in SCOPe 2.05: d3bveb_
  • Chain 'C':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (7-13)
    Domains in SCOPe 2.05: d3bvec_
  • Chain 'D':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (7-13)
    Domains in SCOPe 2.05: d3bved_
  • Chain 'E':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-End)
      • expression tag (8-13)
    Domains in SCOPe 2.05: d3bvee_
  • Chain 'F':
    Compound: Ferritin
    Species: Helicobacter pylori [TaxId:210]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (14-180)
      • expression tag (8-13)
    Domains in SCOPe 2.05: d3bvef_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bveA (A:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bveA (A:)
    hhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeh
    akkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskd
    hatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bveB (B:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bveB (B:)
    hhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeh
    akkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskd
    hatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bveC (C:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bveC (C:)
    hhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeh
    akkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskd
    hatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bveD (D:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bveD (D:)
    hhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeh
    akkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskd
    hatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bveE (E:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bveE (E:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bveF (F:)
    mgsshhhhhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdh
    aaeeyehakkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivd
    haikskdhatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bveF (F:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks