PDB entry 3bvd

View 3bvd on RCSB PDB site
Description: Structure of Surface-engineered Cytochrome ba3 Oxidase from Thermus thermophilus under Xenon Pressure, 100psi 5min
Class: oxidoreductase
Keywords: cytochrome ba3 oxidase, heme, integral membrane protein, copper, electron transport, hydrogen ion transport, ion transport, iron, metal-binding, oxidoreductase, respiratory chain, transmembrane, transport, formylation, xenon
Deposited on 2008-01-07, released 2008-05-20
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-20, with a file datestamp of 2008-05-16.
Experiment type: XRAY
Resolution: 3.37 Å
R-factor: 0.292
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus
    Gene: cbaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-567)
      • engineered (263)
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ80 (Start-167)
      • engineered (3)
    Domains in SCOP 1.75: d3bvdb1, d3bvdb2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus
    Gene: cbaD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bvdc1
  • Heterogens: CU, HEM, HAS, CUA, XE

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3bvdB (B:)
mvdqhkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke

    Sequence, based on observed residues (ATOM records): (download) 
    >3bvdB (B:)
dqhkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3bvdC (C:)
meekpkgalavilvltltilvfwlgvyavffarg

    Sequence, based on observed residues (ATOM records): (download) 
    >3bvdC (C:)
eekpkgalavilvltltilvfwlgvyavffarg