PDB entry 3bvd
View 3bvd on RCSB PDB site
Description: Structure of Surface-engineered Cytochrome ba3 Oxidase from Thermus thermophilus under Xenon Pressure, 100psi 5min
Class: oxidoreductase
Keywords: cytochrome ba3 oxidase, heme, integral membrane protein, copper, electron transport, hydrogen ion transport, ion transport, iron, metal-binding, oxidoreductase, respiratory chain, transmembrane, transport, formylation, xenon
Deposited on
2008-01-07, released
2008-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 3.37 Å
R-factor: N/A
AEROSPACI score: 0.09
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cytochrome c oxidase subunit 1
Species: Thermus thermophilus
Gene: cbaA
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Cytochrome c oxidase subunit 2
Species: Thermus thermophilus
Gene: cbaB, ctaC
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3bvdb1, d3bvdb2 - Chain 'C':
Compound: Cytochrome c oxidase polypeptide 2A
Species: Thermus thermophilus
Gene: cbaD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3bvdc1 - Heterogens: CU, HEM, HAS, XE, CUA
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3bvdB (B:)
mvdqhkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
Sequence, based on observed residues (ATOM records): (download)
>3bvdB (B:)
dqhkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
- Chain 'C':
Sequence, based on SEQRES records: (download)
>3bvdC (C:)
meekpkgalavilvltltilvfwlgvyavffarg
Sequence, based on observed residues (ATOM records): (download)
>3bvdC (C:)
eekpkgalavilvltltilvfwlgvyavffarg