PDB entry 3bva

View 3bva on RCSB PDB site
Description: Cystal structure of HIV-1 Active Site Mutant D25N and p2-NC analog inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: DRUG RESISTANCE, HIV-1, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2008-01-05, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.155
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease (Retropepsin)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (24)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d3bvaa_
  • Chain 'B':
    Compound: Protease (Retropepsin)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (24)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d3bvab_
  • Heterogens: 2NC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bvaA (A:)
    pqitlwkrplvtikiggqlkeallntgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bvaB (B:)
    pqitlwkrplvtikiggqlkeallntgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf