PDB entry 3btd

View 3btd on RCSB PDB site
Description: the crystal structures of the complexes between the bovine beta- trypsin and ten p1 variants of bpti.
Deposited on 1999-03-11, released 2000-03-13
The last revision prior to the SCOP 1.59 freeze date was dated 2000-03-13, with a file datestamp of 2000-03-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.59: d3btde_
  • Chain 'I':
    Domains in SCOP 1.59: d3btdi_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3btdE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3btdI (I:)
    dfcleppytgpcdariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga