PDB entry 3bsm

View 3bsm on RCSB PDB site
Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens
Class: lyase
Keywords: structural genomics, NYSGXRC, target 9262h, clone 9262h1BCt8p1, D-MANNONATE DEHYDRATASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, LYASE
Deposited on 2007-12-25, released 2008-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.243
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3bsma1, d3bsma2, d3bsma3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3bsmb1, d3bsmb2, d3bsmb3
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3bsmc1, d3bsmc2, d3bsmc3
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3bsmd1, d3bsmd2, d3bsmd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bsmA (A:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhweghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsmA (A:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgstekylnhapklfaavrerfgddlhv
    lhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttplaigevfnsi
    hdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlspvclgaaih
    fdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideelaakypye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bsmB (B:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhweghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsmB (B:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgstekylnhapklfaavrerfgddlhv
    lhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttplaigevfnsi
    hdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlspvclgaaih
    fdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideelaakypye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bsmC (C:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhweghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsmC (C:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgstekylnhapklfaavrerfgddlhv
    lhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttplaigevfnsi
    hdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlspvclgaaih
    fdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideelaakypye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bsmD (D:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhweghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsmD (D:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgstekylnhapklfaavrerfgddlhv
    lhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttplaigevfnsi
    hdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlspvclgaaih
    fdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideelaakypye