PDB entry 3bsh

View 3bsh on RCSB PDB site
Description: Barley alpha-amylase isozyme 1 (AMY1) double mutant Y105A/Y380A in complex with inhibitor acarbose
Class: Hydrolase
Keywords: barley alpha-amylase, AMY1, mutant, acarbose, complex, Calcium, Carbohydrate metabolism, Germination, Glycosidase, Hydrolase, Metal-binding, Secreted
Deposited on 2007-12-24, released 2008-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.197
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase type A isozyme
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00693 (0-End)
      • engineered (104)
      • see remark 999 (283)
      • engineered (379)
    Domains in SCOPe 2.07: d3bsha1, d3bsha2
  • Heterogens: BGC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bshA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiacifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsradvgavipagfvtsahgndyavwekngaaatlqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bshA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiacifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsradvgavipagfvtsahgndyavwek