PDB entry 3bsf

View 3bsf on RCSB PDB site
Description: Crystal Structure of the MTA/SAH nucleosidase
Class: hydrolase
Keywords: alpha-beta, HYDROLASE
Deposited on 2007-12-23, released 2009-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.253
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: At4g34840
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bsfa_
  • Chain 'B':
    Compound: At4g34840
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bsfb_
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bsfA (A:)
    megvmgqvekrpistivfivamqkeaqplinrlrlveevntpfpkevtwimfkgmykdln
    inivcpgkdstlgvesvgtvpaslvtyasilaiqpdliinagtaggfkakgacisdvyvv
    stvafhdrripvpvldiygvgmrntfptpnlikelnlkvgrlstgdsmdmsphdeesita
    ndatvkdmegaavayvadifkvptilikgvtdivdgnrptseeflenlaavtakldeslt
    kvidfisgkclsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsfA (A:)
    rpistivfivamqkeaqplinrlrlveevntpfpkevtwimfkgmykdlninivcpgkds
    tlgvesvgtvpaslvtyasilaiqpdliinagtaggfkakgacisdvyvvstvafhdrri
    pvpvldiygvgmrntfptpnlikelnlkvgrlstgdsmdmsphdeesitandatvkdmeg
    aavayvadifkvptilikgvtdivdgnrptseeflenlaavtakldesltkvidfisgkc
    lsdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bsfB (B:)
    megvmgqvekrpistivfivamqkeaqplinrlrlveevntpfpkevtwimfkgmykdln
    inivcpgkdstlgvesvgtvpaslvtyasilaiqpdliinagtaggfkakgacisdvyvv
    stvafhdrripvpvldiygvgmrntfptpnlikelnlkvgrlstgdsmdmsphdeesita
    ndatvkdmegaavayvadifkvptilikgvtdivdgnrptseeflenlaavtakldeslt
    kvidfisgkclsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bsfB (B:)
    rpistivfivamqkeaqplinrlrlveevntpfpkevtwimfkgmykdlninivcpgkds
    tlgvesvgtvpaslvtyasilaiqpdliinagtaggfkakgacisdvyvvstvafhdrri
    pvpvldiygvgmrntfptpnlikelnlkvgrlstgdsmdmsphdeesitandatvkdmeg
    aavayvadifkvptilikgvtdivdgnrptseeflenlaavtakldesltkvidfisgkc
    lsdl