PDB entry 3brg

View 3brg on RCSB PDB site
Description: CSL (RBP-Jk) bound to DNA
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, signaling, transcription, Notch, Activator, Alternative splicing, DNA-binding, Notch signaling pathway, Nucleus, Repressor, Transcription regulation, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2007-12-21, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*dap*dap*dtp*dcp*dtp*dtp*dtp*dcp*dcp*dcp*dap*dcp*dap*dgp*dt)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*dtp*dtp*dap*dcp*dtp*dgp*dtp*dgp*dgp*dgp*dap*dap*dap*dgp*da)-3')
  • Chain 'C':
    Compound: Recombining binding protein suppressor of hairless
    Species: Mus musculus [TaxId:10090]
    Gene: Rbpj, Igkjrb1, Igkrsbp, Rbpsuh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3brgc1, d3brgc2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3brgC (C:)
    gplgsppkrltreamrnylkergdqtvlilhakvaqksygnekrffcpppcvylmgsgwk
    kkkeqmerdgcseqesqpcafigignsdqemqqlnlegknyctaktlyisdsdkrkhfml
    svkmfygnsddigvflskrikviskpskkkqslknadlciasgtkvalfnrlrsqtvstr
    ylhveggnfhassqqwgafyihlldddesegeeftvrdgyihygqtvklvcsvtgmalpr
    liirkvdkqtalldaddpvsqlhkcafylkdtermylclsqeriiqfqatpcpkeqnkem
    indgaswtiistdkaeytfyegmgpvlapvtpvpvveslqlngggdvamleltgqnftpn
    lrvwfgdveaetmyrcgesmlcvvpdisafregwrwvrqpvqvpvtlvrndgviystslt
    ftytpep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3brgC (C:)
    ppkrltreamrnylkergdqtvlilhakvaqksygnekrffcpppcvylmgsgwkkkkeq
    merdgcseqesqpcafigignsdqemqqlnlegknyctaktlyisdsdkrkhfmlsvkmf
    ygnsddigvflskrikviskpskkklknadlciasgtkvalfnrlrsqtvstrylhvegg
    nfhassqqwgafyihlldddetvrdgyihygqtvklvcsvtgmalprliirkvdkqtall
    daddpvsqlhkcafylkdtermylclsqeriiqfqatpcpkeqnkemindgaswtiistd
    kaeytfyegmgpvlapvtpvpvveslqlngggdvamleltgqnftpnlrvwfgdveaetm
    yrcgesmlcvvpdisafregwrwvrqpvqvpvtlvrndgviystsltftytpep