PDB entry 3bqu

View 3bqu on RCSB PDB site
Description: Crystal Structure of the 2F5 Fab'-3H6 Fab Complex
Class: immune system
Keywords: beta sheet, immune system
Deposited on 2007-12-20, released 2008-10-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.276
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2F5 Fab' light chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 3BQU (0-End)
    Domains in SCOPe 2.04: d3bqua1, d3bqua2
  • Chain 'B':
    Compound: 2F5 Fab' heavy chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 3BQU (0-End)
  • Chain 'C':
    Compound: 3H6 Fab light chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PDB 3BQU
    Domains in SCOPe 2.04: d3bquc1, d3bquc2
  • Chain 'D':
    Compound: 3H6 Fab heavy chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PDB 3BQU (Start-240)
    Domains in SCOPe 2.04: d3bqud1
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bquA (A:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyecevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bquA (A:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyecevthqglsspvtksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bquC (C:)
    mtmfslalllsllllcvsdsgaettvtqspaslsmsigekvtircitstdidddmnwyqq
    kpgepprllisdgntlrpgvpsrfsssgygtdfvftienmlsedvadyyclqsdnlpytf
    gggtnleikradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqng
    vlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bquC (C:)
    ettvtqspaslvtircitstdidddmnwyqqkpgepprllisdgntlrpgvpsrfsssgy
    gtdfvftsedvadyyclqsdnlpytfgggtnlradaaptvsifppsseqltsggasvvcf
    lnnfypkdinvkwkidngvlnswtdqdskdstysmsstltltkdeyerhnsytceathks
    pivksf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bquD (D:)
    mgwswiflfllsgtagvhsgvqlqqsgpelvkpgasvkmsckasgysftdyfmhwvkqsh
    gksldwigyincytgatnysqkfkgkatftvdtssntaymqfnsltsedsavyycartsi
    gygssppfpywgqgtlvtvsaakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtv
    twnsgslssgvhtfpavlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bquD (D:)
    gvqlqqsgpelvkpgasvkmsckasgysftdyfmhwvkqshgksldwigyincytgatny
    sqkfkgkatftvdtssntaymqfnsltsedsavyycartsigygssppfpywgqgtlvtv
    saakttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpssprpsetvtcnvahpasstkvdkkivpr