PDB entry 3bqm

View 3bqm on RCSB PDB site
Description: LFA-1 I domain bound to inhibitors
Class: cell adhesion
Keywords: LFA-1 I domain, Leukocyte function associated antigen-1, Alternative splicing, Calcium, Cell adhesion, Glycoprotein, Integrin, Magnesium, Membrane, Polymorphism, Receptor, Transmembrane
Deposited on 2007-12-20, released 2008-08-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.236
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Integrin alpha-L
    Species: HOMO SAPIENS
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (0-181)
      • variant (61)
    Domains in SCOPe 2.03: d3bqmb_
  • Chain 'C':
    Compound: Integrin alpha-L
    Species: HOMO SAPIENS
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (0-181)
      • variant (61)
    Domains in SCOPe 2.03: d3bqmc_
  • Heterogens: BQM, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bqmB (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bqmC (C:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi